PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000322479
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 379aa    MW: 42328.7 Da    PI: 6.1778
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000322479genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.1e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ +++++G+g +W t ++++g++R++k+c++rw++yl
    MDP0000322479 14 KGPWSPEEDATLKAYIEKHGTGgNWITLPQKIGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.84.5e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
    MDP0000322479  69 GGFSEEEDNIICSLYMSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.385966IPR017930Myb domain
SuperFamilySSF466893.38E-2711109IPR009057Homeodomain-like
SMARTSM007172.3E-121364IPR001005SANT/Myb domain
PfamPF002493.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-241569IPR009057Homeodomain-like
CDDcd001672.05E-91662No hitNo description
SMARTSM007173.1E-1167115IPR001005SANT/Myb domain
PROSITE profilePS5129416.42167117IPR017930Myb domain
PfamPF002495.6E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2370117IPR009057Homeodomain-like
CDDcd001672.41E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDATLKAYIE KHGTGGNWIT LPQKIGLRRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYMSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
QRKQQEAQQS RRAAIFKQEM IKRSENNANF VNISAGFFNQ NPYNWPELPV VPVANYQTHD  180
PQLMQDEASI KTMLINLGGR FSHDSDTSTT SFQYPVDISS TSSSDHQFYQ SSIDVLASTS  240
AANSNNYSQF PSTNFDASNG TGGSSSPTIF HGLDDQNNNL QADHLNQLTE LEVYDNSFAH  300
QHQQLGGFYY QASEETLNNG SSAGTSTASA ESEISWGDIN SLVYSTQMVA DYETCCQQAV  360
VVPQDQHSFF AEATYFGLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342185.10.0PREDICTED: transcription factor RAX3-like
TrEMBLM5WKM30.0M5WKM3_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s14630.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-75myb domain protein 84